PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN29374.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 315aa    MW: 35320.4 Da    PI: 7.8498
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN29374.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l  ++k+ Gg+ +W++ +r+ g+ R++k+c++rw +yl
       KHN29374.1 14 KGPWTAEEDEILSSYIKKNGGHgSWRSLPRMAGLLRCGKSCRLRWTNYL 62
                     79*******************9***********99************97 PP

2Myb_DNA-binding482.9e-1568113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++l ++++  lG++ W++Ia+ ++ gRt++++k+ w+++l
       KHN29374.1  68 RGPFTLEEEKLVIQLHGILGNR-WAAIASQLP-GRTDNEIKNLWNTHL 113
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-22565IPR009057Homeodomain-like
PROSITE profilePS5129415.648962IPR017930Myb domain
SuperFamilySSF466897.11E-2811109IPR009057Homeodomain-like
SMARTSM007179.3E-121364IPR001005SANT/Myb domain
PfamPF002498.3E-141462IPR001005SANT/Myb domain
CDDcd001672.97E-81662No hitNo description
PROSITE profilePS5129424.53963117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2566118IPR009057Homeodomain-like
SMARTSM007173.0E-1467115IPR001005SANT/Myb domain
PfamPF002494.0E-1468113IPR001005SANT/Myb domain
CDDcd001673.16E-1070113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRTPCCDKK GLKKGPWTAE EDEILSSYIK KNGGHGSWRS LPRMAGLLRC GKSCRLRWTN  60
YLRPDIKRGP FTLEEEKLVI QLHGILGNRW AAIASQLPGR TDNEIKNLWN THLKKRLKRM  120
GLDPKTHEPL ASSTYPFHKA PASISTRHMA QWESARLEAE ARLSNESSRF SHNNNTNPNS  180
DNNKTTDSDY FLRIWNSEVG EAFRNVHHHK ADNDNNKIIT TNTPTSSCHS PLSAGSSSNK  240
CESIATNADL ASNEQEIITP SSIVKQEFEW GTRGSDSSSS NDMEDSSDTA LQLLLDFPIN  300
NDMSFLEGNS FMCPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26121175108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534572.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0B2RB400.0A0A0B2RB40_GLYSO; Protein ODORANT1
TrEMBLK7LG720.0K7LG72_SOYBN; Uncharacterized protein
STRINGGLYMA09G39721.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23313280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-110myb domain protein 17
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]